PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000263562
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 559aa    MW: 63845.3 Da    PI: 7.9424
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000263562genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.4e-18268314148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd ll+++v+q+G + W+ Ia++++ gR +kqc++rw+++l
    MDP0000263562 268 KGQWTIEEDRLLIQLVEQFGVRKWSHIAQMLP-GRIGKQCRERWHNHL 314
                      799*****************************.*************97 PP

2Myb_DNA-binding46.21e-14345387145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W++ Ed++ ++a+++ G++ W+ Ia++++ gRt++++k++w+
    MDP0000263562 345 KDTWSEGEDKIXIQAHAEIGNK-WAEIAKRLP-GRTENSIKNHWN 387
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129430.446263318IPR017930Myb domain
SuperFamilySSF466896.11E-29265316IPR009057Homeodomain-like
SMARTSM007171.6E-16267316IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-23267317IPR009057Homeodomain-like
PfamPF002493.3E-17268314IPR001005SANT/Myb domain
CDDcd001671.80E-15271314No hitNo description
PROSITE profilePS5129420.582340394IPR017930Myb domain
SMARTSM007173.8E-13344392IPR001005SANT/Myb domain
PfamPF002491.3E-13345387IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-16347388IPR009057Homeodomain-like
CDDcd001672.21E-10347390No hitNo description
SuperFamilySSF466896.11E-29347386IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MKQDQRSRSI LIINAFPPSP FKQARVQWGQ LPKQKLPHFP TTKLYHILLR ASLMELNKLR  60
ENLVSQIHVP LLAPENYVKP YTTKDEFLFE ASSSSKGNYN YLQDFHHLDH QFQVNVSSSN  120
PMFGTHTPCF DPYNDTSYPY DQNSSHQDVN FYDCKPLNVA ENNGAHGQVL DNLQGGSCLK  180
FSTHHRLSNP LDHVVGTSSH MTATNFLPLD CSQDIKPVNF LVPDEVSCIN NADQNXYYRK  240
FGMNGKSRVT GVTRGSTVKG RKKSNVVKGQ WTIEEDRLLI QLVEQFGVRK WSHIAQMLPG  300
RIGKQCRERW HNHLRPDIKV FNNRXTYTCL ALFLEEGKAH RRHEKDTWSE GEDKIXIQAH  360
AEIGNKWAEI AKRLPGRTEN SIKNHWNATK RRQYSKRKCR SKYPRGSVLQ EYIKSLNLDS  420
ASNGTGRQRK NSSANNNGVS TSTKAAAAAH QPQTNLEFSS ANDQFVPSYN DFNEDPNFCF  480
DENIFEEGCS IDSLLDDIPC APDVGEKNSN FDGKNQIDYG NVDKGNFDEK GFDVEMQVDW  540
ESNXVKKEMD LVEMISQVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-382663932104C-Myb DNA-Binding Domain
1msf_C3e-382663932104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008393113.10.0PREDICTED: transcription factor MYB98-like
TrEMBLM5WSR40.0M5WSR4_PRUPE; Uncharacterized protein
STRINGGLYMA05G02300.21e-148(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15703196
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.18e-94myb domain protein 98